PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_C77385A0D.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 728aa    MW: 82329.8 Da    PI: 7.5292
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_C77385A0D.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA36.56.8e-122864135
                   GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                           C  Cg +   Tp++Rrgp g +tLCnaCG+ ++k +l
  Traes_4DL_C77385A0D.2 28 CLRCGISAnaTPHMRRGPMGRRTLCNACGIAWAKGKL 64
                           5567766667***********************9876 PP

2FAR187.22.3e-2798183188
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA ++GFsvrks+s ks  ++ + +rtfvCs+eg+r+++k + ++ +r+r+etr+gC a++ +k ++ +k+++++++ +HnH+
  Traes_4DL_C77385A0D.2  98 EFYNRYAGHMGFSVRKSSSDKS-ADNITRSRTFVCSREGFRKDKKGA-NEVKRPRPETRIGCPARMIIKITSYNKYRIAEFVADHNHQ 183
                            6********************9.555699**************9999.99*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.76E-92274No hitNo description
SMARTSM004013.4E-62277IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-102664IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-93064IPR000679Zinc finger, GATA-type
PfamPF031013.3E-2498183IPR004330FAR1 DNA binding domain
PfamPF105512.3E-25307401IPR018289MULE transposase domain
PfamPF044342.9E-4575619IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.212586622IPR007527Zinc finger, SWIM-type
SMARTSM005756.3E-4597624IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MEFEGEGGIG VGLGDGDGDN RVDEPTRCLR CGISANATPH MRRGPMGRRT LCNACGIAWA  60
KGKLRKVIDS DTPIDDATVA KMVPEVGMEF DNEDKAYEFY NRYAGHMGFS VRKSSSDKSA  120
DNITRSRTFV CSREGFRKDK KGANEVKRPR PETRIGCPAR MIIKITSYNK YRIAEFVADH  180
NHQPAPPSTM HMLRSQRVIT EVQTTECNSS EDSTTPSRFS GDSLVQQAGA FRNVNFLPAD  240
YRSSLCSKRM KNMQPGDAGG VVKYLQSMQL NNPSFFYAVQ LDEDDKLTNI FWADSKSRVD  300
FSYFSDVVCL DTTYKINAHV RPLTLFLGVN HHNKISIFGA ALLYDESVES FKWLFDTFKI  360
ATDGKQPKTI LTDQSSAASA AISAVWPSTI HCLCPWQVFQ NTVKHLNHIF QGSKTFAKDF  420
SRCVYDYEDE EGFLVGWRTM LEKYDLRNNE WLHNLFEDRD KWASAYNRHV FTADIKSSLQ  480
LESVSNVLRK YLSPQFDFLS FFKHYERVLD EHRYAELQAD FHASQSFPRI PPSKMLKQAA  540
NIYTPVVFEI FRREFEMFVD SVIYSCGESG TASDYRVAVT DRPGEYYVRF ESSDLSVVCS  600
CKKFESMGIQ CCHVLKVLDF RNIKELPQKY FLRRWTKDAK SADRSNQEFL NDGASQTLSS  660
CLNAPAPIIG QPQVHLNNLH DHVTSISTSG QQALQGNAHG NQGYAPLAGM NQQPFIGGFP  720
LNHETGLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146150KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2493010.0AK249301.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf33i23, mRNA sequence.
GenBankAK2518850.0AK251885.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf133l23, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985481.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLW5ELL70.0W5ELL7_WHEAT; Uncharacterized protein
STRINGLOC_Os03g08370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-115FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]